PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100182390041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 297aa    MW: 33439.8 Da    PI: 10.0998
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100182390041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.8e-3253106255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   prlrWtpeLH +Fv+ave+LGG+ekAtPk +l+lm+vkgL+++hvkSHLQ+YR+
  Ote100182390041|100182390041  53 PRLRWTPELHLCFVHAVERLGGEEKATPKLVLQLMNVKGLSIAHVKSHLQMYRS 106
                                   8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-3149107IPR009057Homeodomain-like
PROSITE profilePS5129412.85249109IPR017930Myb domain
SuperFamilySSF466898.6E-1650107IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2353108IPR006447Myb domain, plants
PfamPF002497.1E-1054105IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MENNTKKEIE GEGEENESKA MNENSSSNST VEENNGKKAS SGSVRQYVRS KTPRLRWTPE  60
LHLCFVHAVE RLGGEEKATP KLVLQLMNVK GLSIAHVKSH LQMYRSKKID DPSEVISQQR  120
LLIDAGDRHI YNLSQLPMLQ SFNQLSPVSS LRFRDAFLPS SLINNPHEIN NMYLSRASSK  180
FLENDRINLM NQRFWQTRQT ATNTINHHLA ASKAQETPIF KEGRSTLKRK LNSDVNLDLN  240
LSLKTTTPSK EKKMKTDHQE VDSSLSLSLF STPKENIHGG VRKNPGGMGS GSLDLSL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076824.17e-96PREDICTED: uncharacterized protein LOC105160975
TrEMBLA0A068UZK85e-74A0A068UZK8_COFCA; Uncharacterized protein
STRINGPOPTR_0016s12940.12e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85732129